Tag Archives: potatoes

Tay’s Curried Sausage, Potatoes, and Chickpeas over Rice

curriedsausagepotatoeschickpeas

Amazing! Eat Over Rice, with Pita, endless options! 

1 lb Smoked Sausage Link
1 can Chickpeas, drained
1 can Stewed Tomatoes (I used Hunts)
1 can Tomato Soup, undiluted
1/2c Peas (Last hour. Optional. I skipped)
1c Fresh Carrots, sliced
2.5c-3c Potatoes, diced (Russet, Golden, Fingerling)
1/2T Soy Sauce
1/4tsp Cumin Powder
1/2tsp Curry Powder
1/4tsp Paprika Powder
1/2tsp Garlic Powder
1/8tsp Old Bay Seasoning
2 sm. Dried Bay Leaf

Butter Flavor Cooking Spray Crock Pot. Add all, cook on low about 5-8 hours.
Rice: 1c Instant Rice, 1c Water, 1 crushed Vegetable Broth Cube. Add all to Microwave Safe Bowl. Cook, covered, according to directions. Stir half way through. Serve Curry over Rice.

Advertisements

Mexican Marinaded Chicken … SERVED WITH Taco Tay’s TAYter Oles

grilledmeximarinade

Easy! Tasty! LOW CALORIES – LOW CARBOHYDRATES, too!
Ole Season Recipe below!

Mexi Marinade (4-6 hours):
About 1.5 – 2 lb. Chicken Breast, thawed
1 Taco Season Packet
1tsp Garlic Powder
1tsp Cumin
1tsp McCormick’s Montreal Steak Seasoning
2 Dried Bay Leaves, halved
3T Lime Juice (Fridge 100% kind)

Marinade Chicken in ziploc bag. Best on Charcoal Grill. Last hour I remove from fridge to bring closer to room temp before cooking.
Eat as is. Shred, eat over Salads, Rice, on Tacos, Fried Taco Bowls, Mole Enchiladas, etc. MANY USES!

Served with TACO TAY’S TAYter OLES:
grilledmexicanmarinadetaytertotoles

*** TACO TAY’S TAYter OLES – Seasoning: ***
2tsp Lawry’s Seasonal Salt
1/2tsp Old Bay Seasoning
1tsp Paprika
1/2tsp Cumin
1/8tsp Cayenne Powder

Tater Tots, Fries, etc.

Bake or Fry Taters. Once out, season, well, immediately. Serve up.
Or, Make a Taco Dish:
In bowl, add Taters, top with Taco Meat. Then, Toppings of choice.

Tay’s Loaded Taters

taysloadedtaters

Potatoes, halved and center scooped out
Tay’s Chick Rub BEST Season/Rub!
Extra Virgin Olive Oil

Potato Centers
2 oz Cream Cheese
Dried Chives (To taste)
REAL Bacon Pieces (To taste)
Shredded Cheddar Cheese (To taste)
A lil Milk (Very little just enough to blend) or Sour Cream.

For a Quicky: I stab my Potatoes, cover, microwave about 3-4 minutes. Halve (Or cook to your liking (Bake, etc.). Then, halve.). Scoop out desired amount of centers (Careful, hot!). I Oil both sides of Potato halves. I sprinkle both sides of Potato Halves with Tay’s Chick Rub.
In a blender, blend centers with rest of ingredients. Top onto Potatoes. Bake uncovered til done. Mine cook pretty fast, due to Microwaving Technique.

tTt’s Hash

ttthash

1 Jumbo Potato, cubed small
1 Medium Onion, sliced
6 Mushrooms, sliced
A few GOOD shakes of:
Pepper
Dried Oregano
Dried Parsley
Dried Basil
A lil splash of Extra Virgin Olive Oil

Regular Ol’ Sandwich Chedd. Cheese Slices

Add top ingredient to ziploc bag. Mix around. Heat Non Stick Skillet, I still add Butter Flavor Cooking Spray, add Potato Mix. Fry. Shut off heat, top with Cheese Slices. Serve once melted.
Great with Eggs, Toast, and Peppered Bacon:
Heat oven. Lay Lined in pan on top of foil. Sprinkle, well, with Pepper. Bake, uncovered, at 425-450 for about 10-15 minutes.

Optional to add to Hash: 1/3 Green Pepper, minced. 1/3 Red Pepper, minced. Minced Jalapeno.
CLICK HERE to Check Out What We Have to Offer on FACEBOOK. Then, LIKE Us!

Mexi-ed Layered Taters

layeredtaters
Having leftover Layered Dip, it was used to amp up some potatoes.

Potatoes (We use Red or Fingerling), halved, Boiled or Baked*
Leftover MEXICAN LAYERED DIP
1 lb. Ground Meat (Turkey or Beef) *Optional
1/2 pkt. Taco Season *Optional
Pico De Gallo

Bake or Boil Potatoes. Brown Meat, if using. Season with Taco Season. Top over cooked Potatoes. Top with some Layered Taco Dip. Add some Pico De Gallo. Done. Eat.
Try with tTt’s Spuddy Buddies !!! 
*Optional to season and bake potatoes. Or, boil. Or, Even top over mashed potatoes! Or, Tater Tots!
CLICK HERE to Check Out What We Have to Offer on FACEBOOK. Then, LIKE Us! 

Sweet Mashed Taters (Mashed Sweet Potatoes)

mashedsweetpotato

1 Large Sweet Potato, skin on
2-3 Chicken Broth Cubes, crushed
3c Water
2 sm. Dried Bay Leaves

Reserved Broth, from Boiling Potato, to desired consistency
Sour Cream (Optional, I sometimes just add Broth.), to desired consistency
Pinch of Dried Chives (Optional)

Add Water, crushed Cubes, Bay Leaves, and Potato to pan. Boil til soft (RESERVE COOKED BROTH). Remove Potato, add to bowl and mash. Add in Broth, you boiled Potatoes in, to desired amount. IT IS OPTIONAL TO ADD SOUR CREAM. I sometimes do. But, tasty with just Broth, as well.
If adding Sour Cream, do “About” 1/2 Broth and 1/2 Sour Cream, to desired consistency (I do about 1T More Broth than Sour Cream).
Sprinkle in Chives (Optional).

Vegi Broth for Vegetarians, for boiling Potatoes. (Have yet to try.).
I always eyeball it, but, I use “About” 1/4c Reserved Broth for 1 Large Potato… Half of that, if using Sour Cream (1/2 Broth, 1/2 Sour Cream)… Potatoes very in size. So, eyeball to your liking.
CLICK HERE to Check Out What We Have to Offer on FACEBOOK. Then, LIKE Us!

Rice Noodles and Vegis served with side of Masala Potatoes

chinesericenoodles
Considered Vegetarian AND Vegan… But, you wouldn’t know the difference. This is a HOUSEHOLD FAVORITE in a home of MEAT LOVERS! This stems from a PETA Recipe.
Low Carbohydrates Low Calories

1 Pkg. Frozen Japanese Style Vegis
1 Garlic Clove, minced
1.5T Sesame Seed Oil

Sauce:
1/4c Thai Sweet Chili Sauce
1/4c canned Coconut Milk
2T Soy Sauce

Noodles:
About 5-6 oz. Rice Noodles
3.5c Water
2 Vegi broth Cubes (2c worth!)
Squirt of Sesame Oil

Mix sauce. Set aside.
Noodle Prep: Add 3.5c Water to pan WITH crushed Vegi Broth Cube(s). Allow to boil minute til all’s dissolved. Add in noodles. SHUT OFF HEAT immediately. Cover and allow to set 8-10 minutes.
In another skillet, heat. Add in Sesame Oil. Add in Japanese Style Vegis and Garlic. Sautee a bit. Add in sauce. Simmer a few minutes.
Once time’s up on noodles. Drain.
Add noodles into sauce and vegis, TO DESIRED AMOUNT.

Served with Masala Fingerling Potatoes:
Fingerling Potatoes
1T Sesame Seed Oil

1/8tsp – 1/4tsp Sea Salt
1/4tsp Curry
1/8tsp Ginger
1/8tsp Garam Masala
1/2tsp Garlic Powder
1tsp Dried Parsley

Microwave Fingerling Potatoes for about 3-4 minutes, COVERED. Mix Potatoes with Oil. Add in Seasons and mix well. Bake in preheated oven for about 20-25minutes.
chinesericenoodles1
CLICK HERE to Check Out What We Have to Offer on FACEBOOK. Then, LIKE Us!

Re-Posting: Old Cooking Tip- Potatoes

potatocookingtiplogo1
Years ago the moms told us of this. Cuts Baking Time, drastically!
Microwave Potatoes a few minutes (UP TO 5minutes. On average it’s 3-5 min.), prior to BAKING.
-Always microwave Potato WHOLE.
-LARGER Potatoes: I stab a few times on each side, PRIOR TO Microwaving!
-I microwave Covered.

OR, even quicker- Boiling! (No need for Microwaving). – Boiling Potatoes in Water with some CHICKEN BROTH CUBES (Crushed), works! Add in Seasons, if you choose (Garlic Powder, Parsley, Pepper, Etc.). Serve as you would  with Baked Potato Toppings (Sour Cream, Chives, Cheese).
CLICK HERE to Check Out What We Have to Offer on FACEBOOK. Then, LIKE Us!

Similar Posts:


EASY Southwestern Chicken-wiches with BACON WRAPPED FINGERLING POTATOES

easysouthwesternchickenbaconfingerling
Mmmmmm…  Bacon Wrapped Fingerling Potatoes! Great Appetizer…

Bacon Wrapped Fingerlings:
Fingerling Potatoes
1.5tsp Extra Virgin Olive Oil
1T Dried Parsley
1/8 – 1/4tsp Sea Salt (I did 1/8)
1/8tsp Pepper
1/2tsp Garlic Powder
1/8tsp Onion Powder
1tsp Grated Parmesan Cheese (Store shelf kind)

TURKEY Bacon (Or reg. Bacon)
Bacon Glaze:
1T Dijon Mustard
1/8-1/4tsp Red Wine Vinegar (I did 1/4)
1/4tsp Paprika
1/4tsp Brown Sugar

I microwave potatoes, covered, for about 3 minutes. Then, in a bowl, add first 8 Ingredients and mix around. Allow to sit, covered, while you ready Bacon.
Mix glaze. Halve Bacon the LONG way. Lightly brush Glaze onto one side of Bacon. Wrap Bacon around seasoned Potatoes, Glazed side down (Onto potato). Place into Butter Flavor Cooking Sprayed Baking Dish. Lightly brush top (Only the Bacon) with a little more Glaze. Bake, UNCOVERED, at 450 for about 30-35 minutes. Or til Bacon/Potatoes are cooked to liking.
baconwrappedfingerlingpotatoeslogo

Easy Southwestern Chicken-wich:
Frozen Chicken Breasts (Thawed works)
About 1 tsp Hot Chili Oil
Few Splashes of Red Wine Vinegar
1-2 Chicken Broth Cubes, crushed
Good Shake of Chili Powder
Good Shake of Cumin
Good Shake of Dried Parsley
Good Shake of Garlic Powder
Good Shake of Cajun Seasoning
Good Shake of Onion Powder
Good Shake of Pepper

Everything Bagels
Southwestern Ranch
Toppings: Fresh Tomato, Lettuce, Mayo

Fill pan with JUST ENOUGH Water to Boil Chicken. Add in all ingredients, to your liking. I just shake/pour in.  Boil til cooked. Allow to set 1 minute.
Top toasted Bagels with toppings. Eat with Bacon wrapped Fingerlings.
CLICK HERE to Check Out What We Have to Offer on FACEBOOK. Then, LIKE Us!

Mmmm Mmmm Chicken N Vegis (Marinaded Chicken w/ Cheesy Potatoes N Vegis)

redwinevinegarchickenmarinadecheesyvegis

Chicken Breasts, thawed

Chicken Marinade:
2T-1/4c Red Wine Vinegar (I did 1/4c)
1T + 1tsp McCormick’s Grill Mates Backyard Brick Oven Season
1/2tsp Garlic Powder
1tsp Hot Chili Oil (EVOO may work)
1/4tsp Sea Salt

Add marinade to ziploc bag. Add chicken. Mix around. Marinade 4-6 hours. Best on charcoal grill!

Cheesy Potatoes and Vegis:
Golden Potatoes, diced (I believe I did 8 smallish)
1/2tsp Extra Virgin Olive Oil (EVOO)
1 tsp Dijon Mustard
1c Ham, cut small
1c Frozen Carrots
1c Frozen Peas
Lil shy of 1c Frozen Corn
About 2c Frozen Broccoli
1/4tsp Sea Salt
1/2tsp Garlic Powder

Few handfuls of Shredded Mild Cheddar Cheese

I microwave potatoes (Whole, covered) for a few minutes. BUTTER FLAVOR COOKING SPRAY pan. Dice potatoes. Lay into pan. Sprinkle with salt and garlic. Dab on mustard. Mix. Top with vegis, then ham. Bake, covered, 450 for 25minutes. Top with cheese. Bake additional 20 minutes, uncovered.
CLICK HERE to Check Out What We Have to Offer on FACEBOOK. Then, LIKE Us!

Devine Chicken N the Cheesin Ranch Taters (Deliciously Marinaded Chicken N Cheesy Ranch Potatoes)

lemongreekchickenwithcheesyranchpotatoes

Chicken Marinade (5-6 hours):
1 Chobani LEMON GREEK Yogurt
1.5T McCormick’s Montreal CHICKEN Season (Or more to taste)
1/8tsp Sea Salt (Or more to taste)

Add marinade to ziploc bag. Add Chicken. place in fridge. Mix around occasionally. Marinade about 4-6hours. (We did almost 6hrs.). Charcoal Grill is best.

Cheesin Ranch Taters:
About 9 Golden Potatoes (Ours were small)
1/4 tsp Lawry’s Seasonal Salt (Optional)
1 Wish Bone Ranch Dressing/Dip Season Packet
1 Onion, chopped
3/4c Queso Con Salsa
3/4c Shredd. Mild Chedd. Cheese

Butter Flavor Cooking Spray baking dish (Or butter). Dice potatoes. Add to pan. Top with Lawrys Seasonal Salt. Mix some. Sprinkle evenly with Ranch Pkt. Spoon over Queso. Sprinkle Shredd. Cheese (Don’t mix). Top with foil. Bake at 450 for 30 minutes. Uncover bake additional 25minutes.
CLICK HERE to Check Out What We Have to Offer on FACEBOOK. Then, LIKE Us!

 

Honey Mustard Taters N Pig (Honey Mustard Bacon and Potatoes)

honeymustardtatersnpig

GOLDEN Potatoes
4-6 slices Bacon, baked and crumbled  (Reserve 1tsp grease)
1/2-3/4c Shredd. Chedd. Cheese (To top. Optional- I skipped)
Sauce:
1tsp Bacon Grease
1/4c Honey Mustard
1/2tsp Lemon Juice
1T Mayo
1/2T to 1T Fresh Chives,minced
1/2T packed Fresh Parsley (Double if dried)
1/4tsp Paprika
1/4tsp Sea Salt
1/4tsp Pepper

I micowaved potatoes (Whole) for about 2 and a half minutes. Dice. Place into BUTTER FLAVOR COOKING Sprayed baking dish. Toss with sauce and bacon. Bake in oven preheated at 450 for about 35-45 minutes, uncovered. Top with cheese half way through, if using.
CLICK HERE to Check Out What We Have to Offer on FACEBOOK. Then, LIKE Us!

tTt’s Stuffed Taters – With Homemade Bean Recipe!

tttstufftaters

Golden
Potatoes
Onions, chopped
Shredded Cheddar Cheese, minced some
Beans (Homemade Recipe Below. Canned Refried Beans may work)
Taco Sauce
Jalapeno Sour Cream

I microwave potatoes for about 4-5 minutes. Then, halve long way. Scoop out center (Not entire- Leave some in!).
Mix beans with potato centers. Add in onions and cheese. Mix. OVER FILL potatoes. Brush some taco sauce over. Bake about 425-450 for about 35-45minutes. Top with jalapeno sour cream. Enjoy.

Bean Recipe:
16 oz. dried Pinto Beans
6 1/3c Water
4 Chicken Broth Cubes
1T Fresh Basil
1T Fresh Oregano
1/8tsp Sea Salt
1/4tsp Pepper
1/4tsp Garlic Powder
1/2tsp Red Pepper Flakes
1T Onions, minced
2tsp Fresh Jalapeno, deseeded and minced

CLICK HERE to Check Out What We Have to Offer on FACEBOOK. Then, LIKE Us!

Tatered Tacos (Potato Taco Dish)

tacopotatodish

Potatoes, sliced ..OR.. Southwestern Hash Browns (Pepper/Onion kind)
Shredd. Cheddar Cheese
About 1c Lettuce or Spinach, minced (I used spinach)

Cheese Sauce:
3/4c Salsa con Queso
1/2c Shredd. Cheddar Cheese
1/4c Crema Mexicana
1/2T Butter
1/8 Cayenne

Meat Mixture:
1 lb Ground LEAN Turkey Meat*, browned & seasoned with:
1 Taco Season Pkt., skip water (Or homemade recipe)
1/4tsp Paprika
1/4tsp Garlic Powder
1/8tsp Sea Salt
1/4c Salsa (Add at end of cooking)
1/2c Black Olives, chopped
3/4c FRESH Romas, diced
1 sm. Onion, minced

Simmer, stirring frequently, sauce ingredients in pan til melted. Layer bottom of Butter Flavored Cooking Sprayed baking dish with potato slices (1 layer enough to completely cover bottom) or 1/2 hashbrowns. Top with 1/2 cheese sauce and 1/2 meat mixture. Sprinkle LIGHTLY with a little Shredd. Chedd. Cheese. Top with 1/2 minced spinach. Layer more potatoes (1 layer) or hashbrowns, then rest of sauce and meat. Top top with Light sprinkle of cheese (Optional) and shredded lettuce/Spinach. Bake, covered, 375-400 for 45min- 1hr. Last 15-20minutes I uncover. Topping with Sour Cream is optional.

Notes: Beef or Chicken works.
CLICK HERE to Check Out What We Have to Offer on FACEBOOK. Then, LIKE Us!

Winner Winner Chicken Dinner (EASY Lemon Peppered Chicken Dish)

Lemon Pepper Chicken Dinner


Butter Cake Pan.
Heat 2c Water and 2 Chicken Broth Cubes til Dissolved.
Add broth to pan.
Place desired amount of Chicken into pan (Frozen is fine).
Top with good shakes of MCCORMICK’S Lemon Pepper Seasoning.
Cook desired amounts Potatoes in Microwave for 5minutes.
Cut Potatoes in half, add into pan.
Peel desired amount of carrots, place in whole.
Cover with foil. Cook at lower temp til done.
CLICK HERE to Check Out What We Have to Offer on FACEBOOK. Then, LIKE Us!

Loaded Tater Soup (Loaded Baked Potato Soup)

loadedpotatosoup


1T Salted Butter + Some to rub crock
6 Potatoes, SKIN ON, diced (Russet)
5-6 Slices Bacon, baked*, blended/minced
— 1/8tsp Bacon Grease
1/16 tsp Sea Salt
1/4tsp LAWRYS Seasonal Salt
1/4tsp Pepper
1/8tsp Garlic Powder
1/2T Parsley
1/4tsp McCormick Cajun
2T Grated Parmasen Cheese (Store shelf kind)
1tsp Fresh Garlic, minced
About 2.5tsp Garlic Chives, minced
5 Chicken Broth Cubes + 5c Water
A little shy of 1c Red Onion
1 Celery, cut long way and sliced small
1 small Carrot, grated
2 oz. Velveeta, cubed (Last hour)
1/2c Shredded Cheddar Cheese (Last hour)
1c Evaporated Milk (Last hour)

Bake bacon on foil in oven at 450 (No preheat) for about 12minutes. Butter Crock Lightly. Add potatoes. Sprinkle seasoning over. (I always let sit while I cut rest of vegis). Add rest to crock, EXCEPT velveeta, shredd. cheese, and milk. A little over an hour prior to serving, take out about 2/3 of potatoes and a little juice. Blend in blender. Add back to crock. Add cheeses and milk last hour. Last hour I turn to warm, stirring.
*Not sure if this matters, but, had to add the bacon later. Realized I didn’t have any and ended up adding halfway through.

Above soup was PERFECT! You can also add 1c Ham or Chicken to above recipe. But, before adding anything else. Eat this soup the way the recipe states. It’s great!

Check Out Our Other Potato Soups (All Different, all Winners!):
Loaded Tater Soup (Loaded Baked Potato Soup)
Pig N Tater Soup (Ham N Potato Soup)
Western Tater Soup (Southwestern Cheesy Potato Soup)

CLICK HERE to Check Out What We Have to Offer on FACEBOOK. Then LIKE Us!

Country Fried Cow and Mashed Taters (Country Fried Steak N Mashed Potatoes)

countrysteak1

2lb. Steak, cut into larger chunks
1/3c + few TBS. Vegetable Oil
In bowl mix:
1c Flour
1/2 tsp Seasonal Salt
1/4 tsp Pepper
1/4 tsp Garlic Powder
1/4-1/2 tsp Paprika
1T Grated Parmesan Cheese (Store shelf kind)
Beat together:
2 Eggs
1/2c Heavy Whipping Cream
1/8 tsp Sea Salt (Optional)
1 tsp Louisiana Hot Sauce (Optional – I forgot)
SAUCE:
1 can Cream of Chicken
1 Packet Turkey Gravy
1/2c Sour Cream

Mix well the sauce. Set in fridge. Mix flour mixture in one bowl. Beat egg mixture in separate bowl. Toss steak with flour mixture. Pour egg mixture over steak in flour. Give a slight toss. Heat oil on skillet. Brown all sides.
For Tender Fried Steaks (Pictured):
Slightly Butter Flavor Cooking Spray Crockpot. ADD IN SAUCE first. Lay fried steak on top. Leave it be. If stirring is needed, Stir Minimumly! Cook on LOW, or even warm, for 4 hours. I say DO NOT stir often, due to browned batter falling off. It’s a mess if you do. BUT, a delicious mess!!!
OR
Preheat oven 350. Fry in oil til browned. Move to baking dish. Pour sauce over. Bake for 15minutes. Slightly turn. Bake another 10-15 minutes. Or until desired doneness.
OR Crispier(Works for whole steaks, as well):
If you add a lil baking powder and baking soda into the egg mixture for extra crunch, it will turnout too… Fry. Bake at 350, if needed, to desired steak doneness. Heat sauce in pan, top sauce mixture RIGHT BEFORE serving.
Your option on cooking method. All work.
Also, I pour egg batter over, because I think it’s easier than alternate dipping (Flour, egg, then BACK into flour), which I lose most batter on fingers. Especially, working with small pieces. Whole steaks alternate works.

tTt’s Delicious MASHED TATERS
7-10 Potatoes (Reserve juice from cooking potatoes)
1T Parsley
Garlic Powder
3-4T Butter
4-5 Chicken Broth Cubes (For Boiling Potatoes)
1.5c Sour Cream

Boil potatoes in pan with enough water to barely cover potatoes WITH chicken broth cubes. LEAVE THE SKINS ON! Why… Why do yous hate the skins so much? Remove potatoes when tender. RESERVE JUICE. Mash Potatoes, add rest of ingredients PLUS 3/4c water/broth potatoes were cooked in. Mash and stir some more.

CLICK HERE to Check Out What We Have to Offer on FACEBOOK. Then LIKE Us!

Gardening Tips and Designs

30


→ PHOTO GALLERY BELOW ← —

With fear of Blight/Tomato disease/Pests on mind, I “Try” to take extra care. Trying to be as close to ORGANIC, as I could. (Within keeping my sanity). And as CHEAP as I can. Gardening is never done. I now know: Every year is a learning, trial and error, process. Each year, better than the last, yet with different failures along the way. Here’s what I’ve learned along the line.

»Planting, Blight/Disease, and Beneficial Fertilizing«:
Tomato varieties that are early producers or disease resistant: Rutgers, Legend, Old Brook, Golden Sweet Grape, Mountain Fresh, Bush Early Girl, Better Boys, Celebrity Hybrid, Brandywine Pinks, German Johnson, Bush Big Boy, Juliette Cherries, and others.

Seed Planters. Our experience, Foam Cups with holes and Grocery Store Plastic Mushroom Containers (I can get up to 8 plants in this one), work for quicker plants that will be transferred sooner. Husk ones are another working option for all plants. For starting seeds sooner, Jiffy’s didn’t work. They stayed wet, or soaked up all the water from the plants (Dried out). Soggy or Dry. No inbetweens. Creating mold. Ruining plants, too. When transplanting, I never plant the planter into ground, unless it’s intertwined with the roots, in which I break up as much of the container as I can, so roots can get established and not be hindered, slowed, by cups. The husk ones were easier to pull and stretch, to get the plant out. Watering and mold/fungus wasn’t a problem like Jiffy’s.
seedcups

Use Leftover Plastic Spoons, knives, or forks to Label Plants! These are washable and reusable. Wash and put away for next years use! Note: Don’t use those plant pots, use the ones in the photo prior to this one. From experience, I learned they aren’t that great, either dry or too wet.
plasticspoons


Weening plants started inside, means to slowly introduce to a new surrounding, to build stamina. If you start seeds inside, they may not be used to harsh colds outside and will shock them. BUT, a lot of people don’t know this, that weening ISN’T only for cold. It’s for Hot Sun, as well. Some people over cover their plants outside. Placing into plastic containers, then into the sun, where it beats down and cooks them, wilting the plants. I usually don’t have problems w/ transplanting. I’m sure to check daily, to open front of green house if too hot, also, to get some wind (Builds stem strength). Check below on how crates can help in transplanting new plants into ground.

Tomato TipsTomato Seed Starting TIP*– Start in larger container, fill it about a third of way with wet STARTER dirt. (I mix dirt in bowl with warm water) Once sprouted and taller than a few inches, I keep adding dirt, CAREFULLY. About an inch at a time per about 3 inches it grows. Tomatoes grow roots where the stem hits the dirt, making for good rooting system. Also, adding more starter dirt continues to feed them. Once seeds are sprouted and a month in, I start to fertilize. Using my secret weapon… Fish Fertilizer. 

-When Seedlings Grow. I’ve read Wind is Beneficial. Movement Toughens the Stems. I always rotate plants (They lean toward sun) to create movement. And, as foolish as it sounds, I give a little shake every now and then. Light shake. Fans help, too.

Cheap Small Plant Heater. No need to buy expensive ones. A simple small heating pad works great! Keep on lowest setting. Place plants onto a pan or tray, then onto pad. Be sure to keep moist.
seedheater

Outdoor Heated Green House. Get those plants outdoors a little earlier. Or to protect from cold nights! We use an outdoor extension cord, hooked up to timer. It goes on a few hours before sundown and turns off morning time (If warm enough outside). I place the ENTIRE heating pad, and cord/plug-in, inside the green house (To protect from snow/rain). Our 1 small heating pad, on high, is enough to keep entire greenhouse/plants warm enough. You can test yours by placing thermostat inside. Turning on. And checking throughout day and night. Sun onto greenhouse keeps it warm, heating pad continues to, through nights and extra cold days. If no pad, try rope light idea with a greenhouse. (Some light ropes give off heat)
NO GREENHOUSE? Easy Greenhouse Ideas in photo gallery below!
heatedgreenhouse

Companion planting kept in mind when designed the garden layout. *Companion List Under Photo Gallery Below

Garden Staples / Stakes
– Garden Stakes / Staples can get expensive… Save $ with this cheap idea!

-When planting tomatoes, bury slightly sideways. Helps to grow stabilizing roots. You want to bury most the plant. Only about 1/3-1/4 of the plant above ground. I surround area with weed paper (That allows water to get through) and cut holes for tomatoes. Dig holes. Add 1tsp. Epsom Salt, stir into dirt. Add tomatoes slightly sideways. Add starter soil. Surround stem with Garden Safe Woodchips (Helps splashing and disease spread from rain. Keeps cool and moist.). Follow these tips/info, as well:

epsomingarden

Epsom Salt for tomatoes and peppers. At planting time. Then, once a month when flowering.
Reason for Epsom Salt on Tomatoes and Peppers:
Epsom salts can keep plants greener and bushier, enhance production of healthier fruit later in the season, and potentially help reduce blossom-end rot. Also better tasting!
At time of planting, I use starter soil mixed with dirt and 1tsp-1T Epsom Salt (I do tsp), in each hole. Sprinkle every now and then around base (Not touching plants), about every 2 wks. (The weeks I’m NOT fertilizing) … If I’m having Pest Problems… Sprinkling a little around the BASE of plant helps, because, a lot of Pests don’t like going over Salt!

Neptune’s Harvest Organic Fish and Seaweed Fertilizer! This lasted me 2 years. Fertilized every 2 weeks. Adding Molasses to it every other fertilize.
Reason for Fish and Seaweed Fertilizer (Only that brand):
It works! HUGE DIFFERENCE in flowers, fruits, and vegis! Not sure on the science behind it, but it’s awesome. I’ve noticed, as did neighbors, Miracle Grow (Not organic) made plants bigger (If, that). But, not a lot of fruits. (No studies, just experiences). I used Neptune’s Harvest Fish Fertilizer last year and will never do anything else outside that brand. I usually only apply to base of plants, but, apply in evening for burning protection, if any. Cucumbers, I didn’t see as huge of a difference with this, nor potatoes. My pepper plants were small (Started late from seed), it was suggested to add Miracle Grow to help size them… But, with fish fertilizer, we’ve had a huge turn out, even on the little plants. I do like alternating Miracle Grow with Fish for Cucumbers (Our best results). But, for the most part, Miracle Grow seems to help size my plants, but, doesn’t do much for production. Fish does WONDERS!

-Every other fish fertilize, add Blackstrap Molasses (Unsulphered):
Reason for Black Strap Molasses:
1-3T per gallon of water (In my case, I added right to fish fert. mixture). Applied every other fertilizing. It’s a type of fertilizer, fends off pests. It’s high in calcium, magnesium, iron and potassium. It contains sulfur and a bunch of micronutrients. It provides plants with a quick source of energy and encourages the growth of beneficial microorganisms.

Gardening Fert. Schedule (Click to Enlarge):
garden planner

Chicken Manure Box, in center of garden. Soil sloping out to vegis. Drill holes all around a bin, bury into ground. Throw manure in there, cover with dirt with each time. I place top on mine with a few small holes. When it rains, nutrients seep into garden. A lot of chicken manure added directly to small plants could burn plants. Hence, the box with holes using rain water. At end of year add to soil and till in. Proceed with refilling it in the box. (I also add extra dirt to this bin, as well. After placing manure in, top with some dirt to help with smell.)

Thick plastic over garden as soon as season is done, all the way up til growing, helped with weed and disease. A burning process. Cooking it.

-I built a trellis for tomatoes (The box below), and ONLY watered the grounds of plants (To prevent disease, if any, from spreading). They grew up reg. tomato cages, then intertwined through the 6ft. vinyl fence.
—-NEED TO KNOW—- There are Indeterminate Tomatoes and Determinate Tomatoes types.
Indeterminates vine, and grow, and grow. Usually producing til frost. (Hence the tall support-Which mine overgrew).  Determinates are usually compact/bush and grow their fruit within the same time frame (I believe few wks). They do great in containers or cages. Determinates DO NOT need “Suckering” or much/any, “Pruning”. Like you can with Indeterminates.
How: 2x4s and posts. I did not cement them in. I got treated wood, and used rock in holes for drainage. Then stapled green Vinyl-Coated Fence to top half. Still more decorating this to come!
25

– X (Butterfly) Trellis– When Planting Cucumbers, or a climbing  plant, use the X shaped trellis. This: Saves room, creates room, allows more walking space. Also, plant in the inner 4 corners. Sunflower/marigolds (For protection) or more Vegis! Decisions, decisions. But, at least I have more room for Decisions! This keeps cukes off the ground and dry (Mildew Prevention). Easy gathering! Used Vinyl fencing and 5-6 snow poles. In this photo I am testing out Cukes in an above ground idea, using Crates and Weed Paper. I did this in the back of trellis and planted cukes in ground up front of this trellis, so when the front grows, it can shade the crates some, to prevent over heating, if any!  In photos below, sloppy red line shows trellis’s shape. Green X’s are where I planted. I could have squeezed more, but, want them spaced this year.   
xcuketrellis1b

In between the Butterfly Trellis, I have Pepper plants. (Left/Right of trellis). I used an old chair back, painted it, placed into ground for DECORATIVE Plant Support.
chairsupport

Brussel Sprout TrellisOur Pea Trellis (Look in Gallery for photos of Pea Trellis). In between Pea Trellis Arches, I’m growing Brussel Sprouts. In the chicken wire holes, I slid in Cheap bamboo sticks. To hold the Brussels up (They grew in my aisles last year!). Around the Base of the plant is Cheap PVC cut, placed Cheap Copper Tape around top. Buried about an inch. This will help protect my brussels from Slugs/Snails. Sends a charge through them, they HATE it!

Arch Pea Trellis - Multi UsesArch Pea Trellis (More Photos in Gallery Below)- Multi Purpose Uses. Grow Peas along Chicken Wire Arch. Under arches, plant part shade plants, cooler plants. Space Arches about a foot or so apart, and plant more plants in between arches! I grow Lettuce and Spinach under arches, and Brussel Sprouts in between arches.

Root Watering System. I plant 1 tube in between 2 plants. 2ft PVC piping, one end capped, drill holes throughout, ziptie weed paper around it. Dig into ground, leaving it a few inches above ground, capped side down. Don’t over water with this. Once in a while.
rootwatering

-I trimmed, butchered, my tomatoes that showed any signs of damage. Kept my garden debri free. Blight/disease has yet to be a concern!

-With each trimming, I Copper sprayed where I cut. Copper sprayed scissors in between each cut, to limit any possibility of spreading diseases, if any.

»Pest and Fungicide Control«:
PLANT Pest Repellent Plants and DON’T WASTE those deadheads/Plant Trimmings!!! For our sitting area, I planted a mixture of Marigolds, Petunias, Lavender, Spearmint/Mint, etc. Creates a great balance of height and texture to flower pots and SMELLS AMAZING! Even incorporating Basil, Thyme, Rosemary, Grn. Onions, etc…. Looks and Smells DELICIOUS! Note: I got those plants for .50cents. Spearmints weren’t pretty and what paying customers look for, but, spread and grew in nicely! Buy the ON-SALE plants. Most cases, they just need to be placed into the ground to thrive!
Around Cucumbers I planted Marigolds, Garlic, and Chives/Grn. Onions to deter rodents. I, ALSO, use the trimmings of those, Basil… Even, Salvia/Sage seems to work (I have it intertwined with Cucumber Trellis. Seems to be working excellent for flying pests!). Add to the grounds/bases of plants that are bothered. You can look on WIKIPEDIA for List of Pest Repelling Plants. 

pestcontrolplantingcukeherbs

COPPER SPRAY!!! Insecticide and fungicide. I Copper sprayed and trimmed up my cucumbers and tomatoes every 10days, if needed.
Reason for using Copper Spray:
Considered an organic treatment used for fungicide and bactericide in fruits, vegetables and ornamentals against mildew, brown rot, leaf spots, blights, scab, anthracnose and rusts. Please use this in the evening as it kills beneficial buggers. Toxic to fish and other aquatic organisms. Also, can be very harmful to humans, use with caution. Wear mask.

Milk Spray! Great for mildew and insects. One part Skim Milk, 5 parts Water, few drops Regular Dawn Dish Soap.

Sticky Unwind Fly traps throughout garden. Even on ground near plants. You can wrap around trees being bothered, too!

Randomly put these in the garden. Some around plants (Not touch leaves), on ground.

Randomly put these in the garden. Some around plants (Not touch leaves), on ground.

Plant Base Pest Protection in GardenCOPPER Base Plant Protection. Slugs/Snails HATE copper, sends a volt thro them. They will not crawl over. Cut PVC, enough room to place tape & bury some. Place around BASE of plant (You can cut down side to allow to open some to fit around stem). Press into ground, about inch or so.  

2literprotection

2 Liter Pest Control + MORE! It’s hard for most bugs or animals to get around, through, the plastic. Add Two Way Tape  for extra protection! Also, great for ORGANIC GARDENING! Upcycles trash! Collects water and directs it to where it’s needed. Easy watering.
Either Cut and place around plant. Burying some. (Can tape back up to secure, but, dirt helps hold it in place.)
Or, Bury some, add in dirt. Plant Seed! Roots will find their way.
USE A RED BOTTLE FOR TOMATOES! Better Production (More on Red in this post!)

milkyspore
Milky Spore
treatment on the yard (Not garden-No reason, just didn’t) last year for grub control. Works in 2yrs. Lasts for years.
Reason for Milky Spore:
Milky Spore is a natural bacteria that infects the grubs of Japanese Beetles with Milky Spore Disease. The disease paralyzes and kills the host grub. The dead grub breaks down, it releases billions of new spores into the soil. Which, in turn, infect and kill other grubs. Milky Spore is harmless to pets, beneficial insects, fish, bees, birds, other animals, plants, or humans, not a poison. Milky Spore is harmless to crops. It is not a chemical pesticide. It may be used in gardens, around pools and wells.
milkysporeapplierMilky Spore Applier DIY-Took a stick/pole about 3ft long. I take a coffee can, poke holes into bottom. I Duct Tape it at the end of the pole (So holes face down to ground). Fill with Spore. Tap the ground to tap spore onto it. Use stick to guesstimate 3ft (Directions: Apply every 3 ft) -Click photo to enlarge-I do realize drawing is off

Velcro Pest ProtectionVelcro Pest Protection. Some pests don’t like the SCRATCHiness of the ROUGH sided velcro. Snugly, not too snug, place the ROUGH side of velcro, face out, around the base of stem. Adjust as plant stem thickens. ALSO, can cut circle/square piece. Slit the radius (From center, out to 1 side), with small x in center (For stem). Wrap around stem, on base of plant, on ground, scratchy side up. May work for some pests on trees, as well. NON TOXIC – REUSABLE

Plant onions and garlic around plants that are bothered by pests. I did around my potatoes.

-Planted sunflowers in garden and marigolds. BIG HELP for pests. Brings pollinators. Also, great looking. EASY TO GROW!
Reason for Sunflowers:
Attracts ants herd aphids onto sunflowers, keeping them off neighboring plants.

-A piece of foil square, slightly wrinkled, shiny side up. Place around base of plant on ground. I only did about 6x6inches. Not sure why or how, but this worked WONDERS for my cukes and other plants getting attacked. Unfortunately, my cukes were blah this year due to other things.

Fish line. Reflective Jems. Bamboo sticks. String jems onto fish line. Making a border/fence, tie to bamboo sticks along the garden beds. I do 2 rows. Adds Reflecting Sparkles to gardens. Beautiful! Also, helps keep my chickens out of the garden!!! Works too. (More photos below)
jemborder

– If an Organic Garden- Attract Frogs/Toads to the Garden! They eat 10,000 insects in just one summer! Build Frog Houses! Not only beautiful, but beneficial! (Flowers on top will fill-in, beautifying more!) 
How To- Click HERE

frogflowerhome1
Crates and Burlap Bags make for great protection from hot sun and hard rain after transplant. Burlap fits right over cages.

Burlap and crates helps with hard rains (What the above case is), burning sun, and frost. Crates work well, too. Above is case of hard rain. They still get sun, water, but, when burlap is partway on, it breaks up hard rain.

Burlap and crates helps with hard rains (What the above case is), burning sun, and frost. Crates work well, too. Above is case of hard rain. They still get sun, water, but, when burlap is partway on, it breaks up hard rain.

Crates in the garden. (MORE Photos Below)

Herbs did Amazing in Crates. Great for early plant starting keeping moist and warm. Helps break up hard rain and partially shade young plants.

Herbs did Amazing in Crates. Great for early plant starting keeping moist and warm. Helps break up hard rain and partially shade young plants. Lettuce loves crate shade.

Crate Plant Tower. 4 Crates, plus 1 on top. Line with weed paper. Fill with dirt. Using for herbs (Lettuce in back corner). Movable, too! Placing this in center of tomato trellis. Front right crate, I left empty, but, placed tight down into dirt. In holes of bottom of crate, I planted Garlic Chive Seeds. Info below.

chivesincrateThis idea is a part of Crate Tower, above. I’m “Testing” it out. I put the crate TIGHT against the dirt. Placed more dirt inside and rubbed it into the holes, to be sure it was tight and even. In the holes (Not all of em), I (Well, my son) planted Chive seeds. This helps with weeds/grass growing in between. Helps with pests getting to them. And will be more likely to keep coming back each year, vs. being planted in crate. If all else fails… Throw a plant in there, Cilantro! 

Plant Crate Tower. Great for Strawberries! Keeping em off the ground to prevent disease. OR a Beautiful Flower Tower. Flowers fill in to cover entire area. 3 Crates, stack. Lined with Weed Paper. Filled with good Dirt. Cut holes. Plant Flowers/ Strawberries /Both / Etc. Watering can be small holed PVC, Drip Hose intertwined, etc. Be sure it’s secure (Metal rod through center into ground, etc.- Especially, with lil ones!) Note: You can cut to make bigger holes, or use bigger holed crate, etc.
Plant Crate Tower
Crate on Crate GreenhouseCrate on Crate Planter AND Greenhouse. I wanted to test some Cucumbers above ground. This keeps them warm, protects from pests. Great for Early Starting! Opens and Closes for your control. Poke holes on top for rain water to benefit plants. 2 Crates. 1 Plastic Bag. 1 Ziptie.

hangingflowertowerlogo

– HANGING Upcycled Flower Tower:
Reused a Soil Bag. Rolled, tightly, one side- To size of desire. I just heavy duty clear taped it on top, bottom, and center… Worked fine. BE SURE TO PUFF IT OUT AS YOU TAPE, you don’t want to tape it flat! Adding Dirt Helps! I also taped where I was going to cut it at, to reinforce the cut, help it from ripping. For flower openings, I made cuts in it, like this:
hangingflowertowercut1
I, also, sliced a handle in top, being sure it had enough room from the cut to the top of bag. Taped handle cut to reinforce that. I placed flowers in, filled it rest of way with dirt, hung it up.
Now, I think I’ll work on my spacing a little better, for cuts. We will see how it goes!

Reflective Wind Fan Decoration things near plants. SHINY tails off kites, one end tied off. Wind blows to move them, reflecting light and making noise. In turn, keeping pests away. Birds don’t care for the sudden reflective shine. Our problem was momma birds taking seeds. Upside down crates help, too.

»Extra Useful Tips«:
-I over watered Corn during fruiting. Just opened first one! Delicious!

-PICK YOUR PEAS AND GREEN BEANS! More picking, more producing. Beans best stored dry in ziploc bag, in fruit drawer of fridge.

-It just might work!
I’ve broken quite a few plants in my gardening life. As a joke, a bandaid was placed around a green bean plant. It worked! Thrived. Duct taped my tomaters too. Pictured is broken limb of orange pepper plant, from storm. Taped it and the wilted leaves spruced right up, as if never broken. So far so good, like other plants I’ve tested out.
It just might work…

In SOME cases it actually works. So, before giving up on them... Try it out.

In SOME cases it actually works. So, before giving up on them… Try it out.

Potatoes (Grown in ground): Once plants are a foot or so, throw more dirt onto them. Helps keep them cool and prevents sun getting to those close to the top of soil and spoiling them. Do this a few times in the growing year.

Try New Things.  Our newbie is a Potato Tower! I’ve wanted last few years!

– Potato Towers! This year we are gonna try our hand at a few. Along with what we know works (Our Russets in the Good Ol’ Ground). Only downfalls I’ve read about successful towers- The amount of dirt you need!
A few options about potato towers that most people don’t realize. There’s Indeterminate (Usually later season) and Determinate (Usually early season) Potatoes. Indeterminate, with longer lifespan, continue to produce. They are able to vine (To an extent), producing more stolons (Horizontal shoots). If provided it’s nutrient needs. Determinate, usually have a limited lifetime (Early season producer) and will usually set one layer of stolon growth outward with limited produce. Most people have fails with towers, not realizing this info! Using WRONG POTATOES!
I’ve read that INDETERMINATE (Later Season Types) type potatoes do BEST in towers that grow up (Not out sides).  For highest yield. They continue to grow and produce. Once a stem is above ground for so long, it will stop producing tubers. So, continue adding dirt to increase productions. (I’ve read about 7-14days, or sooner, above ground can stop em.) We are trying our hand at Fingerlings (Later seasoner) in 1 tower this year. It’s Late Season and Indeterminate. Also, I’ve read some can remove bottom potatoes when ready, as needed, as they grow up. I will test that on one tower. Also note… Too high of temps will limit production (Towers can heat up, so use straw to help shade some)
My INDETERMINATE Potato Tower Plans (One w/ fence support and one w/o extra support-DIRECTIONS IN PHOTOS-CLICK):

Another Tower Type is one for, mainly, Determinate Potatoes (Usually, shorter season types). These will grow out the SIDES of this tower. (Indet. Potatoes CAN be grown here, too. But, you won’t get it’s yield potential.) DETERMINATE UPDATE: I’ve had MORE success WITHOUT the Burlap! And, I did vertical layers of Hay and Dirt (Using MORE HAY than Dirt, to not over weigh down on the seeds/plants)!
Determinate Potato Tower Plan (Click to Enlarge & Read More):

Red MulchAnother tester for this year is:
Red Mulch Plastic. Creates light wavelengths that bounce up to tomato plants. The phytochromes tell fruits to grow more, and fast. Thus, increasing ripening time and bigger fruit. Studies show more yield. Better ground heating. And Helps against Nematodes. Other colors are proven to help in aiding growth. BLUE is ANOTHER great color for tomatoes! Here’s a great link about more: Click Here Tip: You want the mulch a few feet out from each side of plants.

produce soak– We soak our produce in the sink w/ water and vinegar. It helps to remove/kill some bacteria. Also, with doing this, our produce seems to last longer. When harvesting tomatoes, peppers, cucumbers, strawberries, peas, beans, etc. We noticed they all lasted longer when soaked in vinegar water vs. not.(Some people also amp this up by adding lemon juice, even baking soda in with water- I have yet to try that.)

Water Softener and PlantsWater Softener Owners!!!: After some years, we turned our Water Softener on. I do enjoy the benefits of it… BUT, noticed my Once Thriving Baby Plants were starting to do horrid. Dying. I couldn’t explain it! Only new thing, was watering with Softened Water (I started plants using UN-Softened Water. But, after using it, they started doing horrid). Now, there is NO science behind this. Maybe a Co-Wink-A-Dink. But, once I switched back to non-softened, they did great. (Ones that didn’t see too much of a difference- Peppers. They were good whole way thro.). I did some research of reviews with same problems. Tho, most stated, YES! Ruined my plants! A few stated, no effect. Or, can’t affect plants…
So, for your own determining whether to use or not softened water on your plants… Here is a quote I’ve read (Going against what I believe to be happening- That water softener affected my plants), “The salt is only used to clean the media and is never mixed with or released into the home water feed. Any salt that may still remain in the resin beads after the rinse cycle is infinitesimal at best unless you’re using a totally generic softener system….After the saltwater bath, the beads are rinsed thoroughly to remove any remaining salt residue and this rinse water is discarded. Then, and only then, the softener stops diverting the water and the water is directed back through the resin beads to be softened and then out to the rest of the house.”
My newbies have done horrid since watering with softened water, now better without softened water… Sure, could be altering reasons. May be due to being baby plants. I will be RE-TESTING softener soon. I’m not a scientist. You determine, with your own testing! If you’re using softener and your plants suck… Switch the softener off (Or something similar to that- So, water does NOT run through softener when using.)… Then water plants.

– For all those extra Zucchinis… Try this! Vegetable Candy! CLICK HERE for Recipe  

Other’s junk is my greatest treasure. Keep that crap! Almost all of our decorations were free or dirt cheap at a yard sale. I love a colorful garden. Just spray paint blah decorations. Some I used an old paint brush and stroke another color over the base color to give aged look. Also, to tie in all the colors. I used some ugly wood shelf supports and painted for corner decorations. LAYERS is my rule of thumb. Just keep adding stuff. Added post tops to top of tomato trellis posts. etc.
– Add Sparkle to your Yard and Garden! Cheaply Beautifying your Garden! Tie/Knot Reflective Jems onto Fishing Line. Hang randomly throughout garden. Shimmers and Sparkles. Kids think they’re Fairies! Jems also help to keep chickens out of gardens (Photos of this in Gallery below). Photo Above shows what we have NOW. Multiple sizes and color.  Here’s a Video Example (Only a few SMALL clear beads hung for video- About 1/4 size of finger nail! And, this is through a Dusty Window Screen! CLICK HD Button!):


gardenjune2015layout(Pictured “Starting” 2015 Garden) Garden Decor (This isn’t even all of it!). Upcycled junk, painted. Back of chair, painted and treated for plant support. I love our idea of Colored Stones around the Tomato Trellis, making a CANDYLAND Game for the kids (Miss Pea, Mr. Tomato). Have 1 dice that states Go Ahead, Go Back, Lose a Turn… And another dice that has the color of the stones! !

»Check out the below photos for gardening«:
 Sign ideas, decoration ideas, layout ideas, color scheme ideas, pest control ideas, etc.
»Companion List is Below these photos!«

companiongardeninglogo
Companion planting, in gardening, is the planting of different crops in proximity for pest control, pollination, providing habitat for beneficial creatures, maximizing use of space, and increase crop productivity.
*Companion Planting:
Asparagus
aster flowers, dill, tomatoes, parsley, basil, mints, marigolds AVOID onion, garlic, potatoes
Beans Legumes Phaseolus and vicia
beets, cukes, cabbage, cauli., potato, lettuce, squash AVOID Tomatoes, chili peppers
Beets
bush beans, onions, catnip, garlic, lettuce, mint AVOID runner or pole beans
Bush Beans
celery, strawberry AVOID Alfalfa soybeans, dry beans
Pole Beans
radishes AVOID sunflowers, beets
broccoli
tomatoes, lettuce, beets
Brassicas (broccoli, brussels, cabbage, cauliflower, chinese cabbage, radish, turnip)-
beets, spinach, chard, aromatic plants, celery, chamomile, marigolds, sage, peppermint, sage, rosemary, onions, potatoes, geraniums, alliums, nasturtium, thyme, beans AVOID nightshade, tomatoes, peppers, pole beans, STRAWBERRIES
Brussels
sage, thyme
cabbage
marigolds, dill, onions, beets, lettuce, garlic AVOID grapes
Carrots
lettuce, onions, shallots, sage, beans, flax AVOID dill, parsnip, radish
Cauliflower
spinach, peas
Celery
daisies, snap dragons, leeks, tomatoes, cabbage, bush beans AVOID corn aster flowers
Corn (Maize sea mays)-
Sunflowers, legumes (beans, peas, soybeans), peanuts, clover, morning glory, parsley, potato AVOID tomato, celery
Cucumber– radishes, marigolds, sunflower, peas, beans, beets, carrots, dill, onions, garlic, celery, spinach AVOID potato, aromatic herbs
Lettuce
radish, beets, onions, beans, carrots, cukes, strawberries, broccoli, thyme, cilantro AVOID celery cabbage cress, parsley
Onion
carrots, beets, strawberry, tomato, lettuce, chamomile AVOID lentils
Peas
garlic, turnip, cauliflower
Peppers
beans, tomatoes, marjoram, okra, geraniums, petunias, sunflowers, onions, basil AVOID beans, kale, cabbage, brussel sprouts
Potatoes
horseradish, beans, peas, onions, garlic, clover AVOID carrots, cukes, pumpkin, raspberries, squash, sunflower, tomato
Pumpkin– catnip, radishes, nasturtiums AVOID potatoes
Radish
lettuce, pole beans, nasturtiums AVOID grapes
Spinach
strawberries, peas, beans, cauliflower
Squash
beans, catnip, radishes, marigolds, nasturtiums
Sweet Potato
Okra
Tomatoes
asparagus, basil, oregano, parsley, marigolds, alliums, garlic, leeks, celery, geraniums, petunias, nasturtium, coriander, corn, dill, barley, carrots, eggplant, okra, flower strips? AVOID alfalfa, corn, fennel, chili peppers, peas, dill, potatoes, beetroot, rosemary
Apple- AVOID CEDAR, walnuts!!!
Strawberry
bush beans, caraway, bush lettuce, beans, onions, spinach AVOID tomatoes, potatoes, egglpant, peppers, melons, okra, mind, roses
Chives
apples, carrots, roses, tomatoes, broccoli, carrots, cabbage, etc.  AVOID beans peas
Cilantro
cabbage, spinach, lettuce, tomatoes, beans, peas AVOID dill
Dill
cabbage, corn, lettuce, onions, cukes AVOID carrots, tomatoes, cilantro
Garlic
roses, tomatoes, cukes, lettuce, celery, peas, CHINESE cabbage, potatoes AVOID cabbage, grapes
Lemon Grass
Eggplant
Oregano
Basil
Parsley
Asparagus, corn, tomatoes, apple, rose AVOID lettuce Alliums
Sunflower helps Peppers, corn, cukes, tomatoes AVOID pole beans ::: Was grown as a companion for corn(maize) before modern Europeans arrived in the Americas, supposedly increases their production, ants herd aphids onto sunflowers, keeping them off neighboring plants. Works as a trap plant for thrips keeping them off of bell peppers
Marigolds
Most plants, especially tomatoes and peppers, cucurbits (cucumbers, gourds, squash), alliums, brassicas, zucchini ::: Marigolds are a wonder-drug of the companion plant world, invoking the saying “plant them everywhere in your garden”. French marigolds (T. patula) produce a pesticidal chemical from their roots, so strong it lasts years after they are gone.
Mexican marigolds (T. erecta) do the same, but are so strong they will inhibit the growth of some more tender herbs. Stinking Roger (T. minuta) has also been found effective against certain perennial weeds.

CLICK HERE to check out how I start my seeds, prep for Garden Season: https://dinkingaround.wordpress.com/2014/02/23/already-started-my-zone-4-garden/

LIKE Us on our Facebook Page to keep up with our great Recipes and Ideas. CLICK HERE to Check Out What We Have to Offer! … Then LIKE US!

Check Out Our Recipe Gallery HERE
Check Out Our Tips & Idea Gallery HERE
Check Out Our Gardening Gallery HERE
Check Out Our DIY Decorating Gallery HERE